PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11409_iso_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 246aa    MW: 25631.1 Da    PI: 6.2246
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11409_iso_6genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82236.22.1e-1127173150
                                DUF822  73 skpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                                           +kp ++++++g s++asp+ss+q        +sp +sy++sp+sssfpsp+s+  + +a+ +sl+p+l++ls+
  cra_locus_11409_iso_6_len_1032_ver_3   2 CKPVDRMDIMGGSTTASPCSSYQ--------PSPGTSYNPSPASSSFPSPTSSYANVNADGNSLIPWLKNLSS 66 
                                           8999*******************........*************************9*9************99 PP

                                DUF822 146 vsssl 150
                                           +sss+
  cra_locus_11409_iso_6_len_1032_ver_3  67 ASSSA 71 
                                           87765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.4E-9265IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
XCKPVDRMDI MGGSTTASPC SSYQPSPGTS YNPSPASSSF PSPTSSYANV NADGNSLIPW  60
LKNLSSASSS ASSSKFHHLY HGGSISAPVT PPLSSPTCQT PRMKTNWDDS SARAFWGGSH  120
HSFLPLSTPP SPGRPIIPDS EWFAGSGGPT SPTFSLVSSN PFGFKFGNIG RSGSLMCTPG  180
QSGTCSPAIP PGADQTADVP MAEVISDEFA FGNIRGGLVK PWEGERIHED AGLDDLELTL  240
GSSKTR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010644097.11e-109PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV883e-88BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A068UCW31e-116A0A068UCW3_COFCA; Uncharacterized protein
TrEMBLF6H1V61e-109F6H1V6_VITVI; Putative uncharacterized protein
STRINGVIT_19s0014g00870.t011e-109(Vitis vinifera)